Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein Rv2637-MT2715 (Rv2637, MT2715)

Recombinant Uncharacterized membrane protein Rv2637-MT2715 (Rv2637, MT2715)

SKU:CSB-CF351348MVZ

Regular price $2,191.00 CAD
Regular price Sale price $2,191.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P63911

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA

Protein Names:Recommended name: Uncharacterized membrane protein Rv2637/MT2715

Gene Names:Ordered Locus Names:Rv2637, MT2715 ORF Names:MTCY441.07

Expression Region:1-218

Sequence Info:full length protein

View full details