Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein Rv1735c-MT1776 (Rv1735c, MT1776)

Recombinant Uncharacterized membrane protein Rv1735c-MT1776 (Rv1735c, MT1776)

SKU:CSB-CF301786MVZ

Regular price $2,160.20 CAD
Regular price Sale price $2,160.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P71993

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLYVAVGSLVVARLLLYPLRPADLTPPYWVAMGATAITVLAGAHIVEMADAPMAIVTSG LVAGASVVFWAFGPWLIPPLVAASIWKHVVHRVPLRYEATLWSVVFPLGMYGVGAYRLGL AAHLPIVESIGEFEGWVALAVWTITFVAMLHHLAATIGRSGRSSHAIGAADDTHAIICRP PRSFDHQVRAFRRNQPM

Protein Names:Recommended name: Uncharacterized membrane protein Rv1735c/MT1776

Gene Names:Ordered Locus Names:Rv1735c, MT1776

Expression Region:1-197

Sequence Info:full length protein

View full details