Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized HTH-type transcriptional regulator Rv1816-MT1864 (Rv1816, MT1864)

Recombinant Uncharacterized HTH-type transcriptional regulator Rv1816-MT1864 (Rv1816, MT1864)

SKU:CSB-CF303817MVZ

Regular price $2,214.80 CAD
Regular price Sale price $2,214.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P67438

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCQTCRVGKRRDAREQIEAKIVELGRRQLLDHGAAGLSLRAIARNLGMVSSAVYRYVSSR DELLTLLLVDAYSDLADTVDRARDDTVADSWSDDVIAIARAVRGWAVTNPARWALLYGSP VPGYHAPPDRTAGVATRVVGAFFDAIAAGIATGDIRLTDDVAPQPMSSDFEKIRQEFGFP GDDRVVTKCFLLWAGVVGAISLEVFGQYGADMLTDPGVVFDAQTRLLVAVLAEH

Protein Names:Recommended name: Uncharacterized HTH-type transcriptional regulator Rv1816/MT1864

Gene Names:Ordered Locus Names:Rv1816, MT1864 ORF Names:MTCY1A11.27c

Expression Region:1-234

Sequence Info:full length protein

View full details