Skip to product information
1 of 1

Gene Bio Systems

Recombinant Turnip yellows virus Protein P1 (ORF1)

Recombinant Turnip yellows virus Protein P1 (ORF1)

SKU:CSB-CF357690TJR

Regular price $2,174.20 CAD
Regular price Sale price $2,174.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Turnip yellows virus (isolate FL-1) (TuYV) (BWYV-FL1)

Uniprot NO.:P09506

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTAPQGRVFAQEDIAEIEGLYAQVMKRVQQAEDFKPKTGKYWGDMEDDEDIFFESKEDLS GNGVRGTVRGTNGEGSSTPKTSNVDGKEMMEKIISSLVGKINLENIERKVIEEISAKAMK TPKSRRRRAPKKQPESSKDTSPRSTTGKYQPPHVRSPASVTAANCPNTTTPSKKKNLAGG RPSSGTIPRWVRKQAASAGPSSAPKQN

Protein Names:Recommended name: Protein P1 Alternative name(s): 66.2 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25

Gene Names:ORF Names:ORF1

Expression Region:401-607

Sequence Info:full length protein

View full details