Gene Bio Systems
Recombinant Turkey rhinotracheitis virus Small hydrophobic protein(SH)
Recombinant Turkey rhinotracheitis virus Small hydrophobic protein(SH)
SKU:CSB-CF333800TJK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Turkey rhinotracheitis virus (TRTV)
Uniprot NO.:P33496
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSTVNLGSDTASKRTVIKSRCNSCCRILVSCVAVICAILALIFLVATIGLSVKLAFTVQ EVHNCKQKLSGASTTTAAIYTTPSTMIEALQTNQLKLTTNERRSTPPDCLVEKKLCEGEV RYLKTKGCLGAREGEDLNCIDLVVECVGKPCGHNEDYKECICTNNGTATKCCYN
Protein Names:Recommended name: Small hydrophobic protein
Gene Names:Name:SH
Expression Region:1-174
Sequence Info:full length protein
