Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C

CSB-YP326146TIF
Regular price
$1,263.14 CAD
Sale price
$1,263.14 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P24478

Gene Names: N/A

Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Expression Region: 22-270aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 29.4 kDa

Alternative Name(s): rRNA N-glycosidase Cleaved into the following chain: Ribosome-inactivating protein karasurin-A

Relevance: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Reference: "Amino acid sequences and ribosome-inactivating activities of karasurin-B and karasurin-C."Kondo T., Mizukami H., Takeda T., Ogihara Y. Biol. Pharm. Bull. 19:1485-1489(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share