Skip to product information
1 of 1

Gene Bio Systems

Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

SKU:CSB-YP304437HYEa4

Regular price $1,133.75 CAD
Regular price Sale price $1,133.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P79073

Gene Names: hfb2

Organism: Hypocrea jecorina (Trichoderma reesei)

AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Expression Region: 16-86aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 23.2 kDa

Alternative Name(s): Hydrophobin II

Relevance: Responsible for spore hydrophobicity and protection.

Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details