Recombinant Triangle waterfern Cyanovirin-N homolog

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Triangle waterfern Cyanovirin-N homolog

CSB-YP309974CGP
Regular price
$1,170.00 CAD
Sale price
$1,170.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Ceratopteris richardii (Triangle waterfern)

Delivery time: 3-7 business days

Uniprot ID: P86326

AA Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE

Tag info: N-terminal 6xHis-tagged

Expression Region: 28-142aa

Protein length: Full Length of Mature Protein

MW: 14.4 kDa

Alternative Name(s):

Relevance: Mannose-binding lectin

Reference: "The evolutionarily conserved family of cyanovirin-N homologs: structures and carbohydrate specificity."Koharudin L.M.I., Viscomi A.R., Jee J.-G., Ottonello S., Gronenborn A.M.Structure 16:570-584(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share