Gene Bio Systems
Recombinant Treponema pallidum UPF0092 membrane protein TP_0409.1 (TP_0409.1)
Recombinant Treponema pallidum UPF0092 membrane protein TP_0409.1 (TP_0409.1)
SKU:CSB-CF349709TPR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Treponema pallidum (strain Nichols)
Uniprot NO.:P58007
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCPARSRMKTMPHRTLLQITTANGGWIPPLAIGVVCLIFYLFVFAPNLREQKRTQALIKN IKKGDPVVTIGGIHGVVSVVREHSLVIKVNEHGTLEVSRSAIARINDRRGVSNPKTDCDS KPGVPLTGVDKEIAR
Protein Names:Recommended name: UPF0092 membrane protein TP_0409.1
Gene Names:Ordered Locus Names:TP_0409.1
Expression Region:1-135
Sequence Info:full length protein
