
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P54190
Gene Names: TES-26
Organism: Toxocara canis (Canine roundworm)
AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Expression Region: 22-262aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 41.9 kDa
Alternative Name(s): Toxocara excretory-secretory antigen 26 ;TES-26
Relevance: Binds phosphatidylethanolamine.
Reference: An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.