Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

CSB-BP347478THA
Regular price
$585.70 CAD
Sale price
$585.70 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Others

Uniprot ID: P54190

Gene Names: TES-26

Organism: Toxocara canis

AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Expression Region: 22-262aa

Sequence Info: Full Length of Mature Protein

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

MW: 27.9 kDa

Alternative Name(s): Toxocara excretory-secretory antigen 26 Short name: TES-26

Relevance: Binds phosphatidylethanolamine.

Reference: "An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins."Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share