Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Others
Uniprot ID: P54190
Gene Names: TES-26
Organism: Toxocara canis
AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Expression Region: 22-262aa
Sequence Info: Full Length of Mature Protein
Source: Baculovirus
Tag Info: N-terminal 6xHis-tagged
MW: 27.9 kDa
Alternative Name(s): Toxocara excretory-secretory antigen 26 Short name: TES-26
Relevance: Binds phosphatidylethanolamine.
Reference: "An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins."Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.