Gene Bio Systems
Recombinant Tortula ruralis Photosystem I reaction center subunit V, chloroplastic(PSAG)
Recombinant Tortula ruralis Photosystem I reaction center subunit V, chloroplastic(PSAG)
SKU:CSB-CF890402TGX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tortula ruralis (Star moss) (Twisted moss)
Uniprot NO.:Q9SPM4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ANTSFIISASTAALLALGRFVFLPFQRSMVSRHGLPEQNGVPTTRRVTAVRRRWWSMLKT NDPAGFTLVDVLAWGALGHAVGFFILATATNGYNGFQ
Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G
Gene Names:Name:PSAG
Expression Region:16-112
Sequence Info:full length protein
