Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tolumonas auensis UPF0114 protein Tola_1474 (Tola_1474)

Recombinant Tolumonas auensis UPF0114 protein Tola_1474 (Tola_1474)

SKU:CSB-CF505066TOQ

Regular price $2,115.40 CAD
Regular price Sale price $2,115.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Tolumonas auensis (strain DSM 9187 / TA4)

Uniprot NO.:C4LES1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFIERLMYSARWIMAPIYLGLSLALLALGIKFFQEVFHIFTVIISMKEVELILIILSL IDISLVGGLIVMVMYSGYENFVSRLDLDDHDDKLSWLGKLDAGSLKNKVAASIVAISSIH LLKVFMNTENIADDKIKWYLLIHITFVMSAFAMGYLDKLLRDKDSPH

Protein Names:Recommended name: UPF0114 protein Tola_1474

Gene Names:Ordered Locus Names:Tola_1474

Expression Region:1-167

Sequence Info:full length protein

View full details