Gene Bio Systems
Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 10(nqo10)
Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 10(nqo10)
SKU:CSB-CF687924TNT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Uniprot NO.:Q56225
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYA GAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLK GGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKASRAKEAEKREEVAR
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit 10 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I chain 10 NDH-1 subunit 10
Gene Names:Name:nqo10 Ordered Locus Names:TTHA0093
Expression Region:1-176
Sequence Info:full length protein
