Gene Bio Systems
Recombinant Thermosynechococcus vulcanus Photosystem I reaction center subunit PsaK(psaK)
Recombinant Thermosynechococcus vulcanus Photosystem I reaction center subunit PsaK(psaK)
SKU:CSB-CF326053TNI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermosynechococcus vulcanus (Synechococcus vulcanus)
Uniprot NO.:P23318
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TLPDTTWTPSVGLVVILSNLFAIALGRYAIQSRGKGPGLPIALPALFEGFGLPELLATTS FGHLLAAGVVSVGLQYAGAL
Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.5 kDa polypeptide Photosystem I subunit X
Gene Names:Name:psaK
Expression Region:6-85
Sequence Info:full length protein
