Gene Bio Systems
Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107(Ta0107)
Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107(Ta0107)
SKU:CSB-CF875797TND
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Uniprot NO.:Q9HLW7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQSIILFIPALIANSGAVITGGHFIIDRGKKFIDGRRILGNGKTLSGYAGGIAIGTVTGF IIYLISTLFNYALGTYGTLAEAIIIPFIMATGSLTGDIAGSFVKRRIGIDRGGKGGLLDQ WPFALMAFLFLYIFERPFFMYHYFYVTMIVILVIVPPIHRAVNIIGYKMHKKDVPW
Protein Names:Recommended name: UPF0290 protein Ta0107
Gene Names:Ordered Locus Names:Ta0107
Expression Region:1-176
Sequence Info:full length protein
