Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107(Ta0107)

Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107(Ta0107)

SKU:CSB-CF875797TND

Regular price $2,129.40 CAD
Regular price Sale price $2,129.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)

Uniprot NO.:Q9HLW7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQSIILFIPALIANSGAVITGGHFIIDRGKKFIDGRRILGNGKTLSGYAGGIAIGTVTGF IIYLISTLFNYALGTYGTLAEAIIIPFIMATGSLTGDIAGSFVKRRIGIDRGGKGGLLDQ WPFALMAFLFLYIFERPFFMYHYFYVTMIVILVIVPPIHRAVNIIGYKMHKKDVPW

Protein Names:Recommended name: UPF0290 protein Ta0107

Gene Names:Ordered Locus Names:Ta0107

Expression Region:1-176

Sequence Info:full length protein

View full details