Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermococcus gammatolerans UPF0290 protein TGAM_2129 (TGAM_2129)

Recombinant Thermococcus gammatolerans UPF0290 protein TGAM_2129 (TGAM_2129)

SKU:CSB-CF512658TMP

Regular price $2,121.00 CAD
Regular price Sale price $2,121.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)

Uniprot NO.:C5A2X0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGALSSMFWALWYILPAYFANASPVLLGGGRPIDGGRKWRDGNRILGDGKTWRGFLGGVS VGTLVGVLQYYLTPAFYGSLKTAVLLAFLLSFGALMGDLVGSFIKRRLNLPRGYPAVGLD QLGFLISALAFAYPVKTISSGQMLFLLIFTPLVHWGANYFAYKMGWKSVPW

Protein Names:Recommended name: UPF0290 protein TGAM_2129

Gene Names:Ordered Locus Names:TGAM_2129

Expression Region:1-171

Sequence Info:full length protein

View full details