Recombinant Thermobifida fusca  Protein CrcB homolog 1(crcB1)

Recombinant Thermobifida fusca Protein CrcB homolog 1(crcB1)

CSB-CF677435TAAF
Regular price
$1,462.00 CAD
Sale price
$1,462.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermobifida fusca (strain YX)

Uniprot NO.:Q47KG0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTALLTAVGAAFGALLRYCLNCAAAARGTTGFPWGTWCVNTLGCLLAGALAALPLPAAVA ALAGPGLCGGLTTYSTFSYETVRLLAERKWTHALGNIGANLAAGVGAAVLGMAAVGWFLR

Protein Names:Recommended name: Protein CrcB homolog 1

Gene Names:Name:crcB1 Ordered Locus Names:Tfu_3029

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share