Skip to product information
1 of 1

Gene Bio Systems

Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)

SKU:CSB-CF493533TKZ

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)

Uniprot NO.:B8MJJ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADQADLLESPQFEEETSMQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNR MFRARIYAQFFTLLAVVAGGMYYKTERKQRREFERKVEERKAQEKRDAWLRELEAREKED KGWRERHAAVSEAANNPVGVSAVVAGKKEEEEKGVDGNVNQAPQEEGGVKRGTGILDAVK ALVRGKKD

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:aim31 ORF Names:TSTA_046460

Expression Region:1-188

Sequence Info:full length protein

View full details