Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tachypleus tridentatus Tachylectin-2

Recombinant Tachypleus tridentatus Tachylectin-2

SKU:CSB-EP634622TAH

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q27084

Gene Names: N/A

Organism: Tachypleus tridentatus (Japanese horseshoe crab)

AA Sequence: VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF

Expression Region: 20-255aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 42.8 kDa

Alternative Name(s): Lectin L10c

Relevance: Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.

Reference: "Purification, characterization, and cDNA cloning of a 27-KDA lectin (L10) from horseshoe crab hemocytes."Okino N., Kawabata S., Saito T., Hirata M., Takagi T., Iwanaga S.J. Biol. Chem. 270:31008-31015(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details