Skip to product information
1 of 1

Gene Bio Systems

Recombinant Syntrophobacter fumaroxidans UPF0059 membrane protein Sfum_0431 (Sfum_0431)

Recombinant Syntrophobacter fumaroxidans UPF0059 membrane protein Sfum_0431 (Sfum_0431)

SKU:CSB-CF370508SVD

Regular price $2,137.80 CAD
Regular price Sale price $2,137.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

Uniprot NO.:A0LFC9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVVETVLVALALGCDAFAVGMGVGTRFCNPRQIFRLSFHFGLFQMMMPIAGWFVGSRAA DLVSTWGPWISFALLLFIGGKMAYESFRSLEAEDGECPDPTKGSSLVMLSVATSMDALGV GFSFGILGQQLFLSAVWIGITAGIMTWGAMRLGNRLSRQFGRRMETVGGLILVAIAVKLL LF

Protein Names:Recommended name: UPF0059 membrane protein Sfum_0431

Gene Names:Ordered Locus Names:Sfum_0431

Expression Region:1-182

Sequence Info:full length protein

View full details