Gene Bio Systems
Recombinant Synechocystis sp. Ycf49-like protein(sll0608)
Recombinant Synechocystis sp. Ycf49-like protein(sll0608)
SKU:CSB-CF687836SSQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechocystis sp. (strain PCC 6803 / Kazusa)
Uniprot NO.:Q55720
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHF FDNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQPSAPKP
Protein Names:Recommended name: Ycf49-like protein
Gene Names:Ordered Locus Names:sll0608
Expression Region:1-104
Sequence Info:full length protein
