1 1

Gene Bio Systems

Recombinant Synechocystis sp. Cytochrome b6-f complex iron-sulfur subunit 1(petC1)

Recombinant Synechocystis sp. Cytochrome b6-f complex iron-sulfur subunit 1(petC1)

CSB-CF300416SSQ

$2,132.20 CAD
$2,132.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:P74714

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MDNTQAIAPPSYSRRQLLNFLAGTTVAVTASAGAYAMGKFFVPPAEKGGAGGGIIAKDVL GNPIPASQILAEAPGTRALVAGLAGDPTYLIVKEDGSLDSIGIVDSCTHLGCTFPWNGND QEFQCPCHGSRYHPDGSVARGPAPLPLKIVQVAVVDDQIFISPWTDLDPRTGEKPWWV

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 1 EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1 Short name= ISP 1 Short name= RISP 1 Rieske iron-sulfur

Gene Names:Name:petC1 Ordered Locus Names:slr1185

Expression Region:1-178

Sequence Info:full length protein

View full details