Recombinant Synechococcus sp. Photosystem II reaction center protein Z(psbZ)

SKU: CSB-CF463653FQA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Uniprot NO.:B1XLJ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTILFQLALAALVALSFLMVIGVPVAYASPTNWEQSKSLIFVGSIAWTVLVIAVGVLNFF VI

Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z

Gene Names:Name:psbZ Ordered Locus Names:SYNPCC7002_A0135

Expression Region:1-62

Sequence Info:full length protein