Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)
Uniprot NO.:Q2JJZ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMLVFQIALLVLVLYSLLLVVAVPVLYSSASDWSRAKNVILVGSLLWVLMVIGVGVLSFL K
Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z
Gene Names:Name:psbZ Ordered Locus Names:CYB_2057
Expression Region:1-61
Sequence Info:full length protein