Skip to product information
1 of 1

Gene Bio Systems

Recombinant Surface presentation of antigens protein SpaQ(spaQ)

Recombinant Surface presentation of antigens protein SpaQ(spaQ)

SKU:CSB-CF363116SBH

Regular price $1,996.40 CAD
Regular price Sale price $1,996.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella gallinarum

Uniprot NO.:P0A1M1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCL FLLSGWYGEVLLSYGRQVIFLALAKG

Protein Names:Recommended name: Surface presentation of antigens protein SpaQ

Gene Names:Name:spaQ

Expression Region:1-86

Sequence Info:full length protein

View full details