Gene Bio Systems
Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain(atpP)
Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain(atpP)
SKU:CSB-CF351706FPN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Uniprot NO.:P62021
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAA GIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLMLFGKF
Protein Names:Recommended name: Membrane-associated ATPase C chain Alternative name(s): Sul-ATPase proteolipid chain
Gene Names:Name:atpP Ordered Locus Names:STK_14390
Expression Region:1-101
Sequence Info:full length protein
