Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain(atpP)

SKU: CSB-CF351706FPN

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)

Uniprot NO.:P62021

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAA GIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLMLFGKF

Protein Names:Recommended name: Membrane-associated ATPase C chain Alternative name(s): Sul-ATPase proteolipid chain

Gene Names:Name:atpP Ordered Locus Names:STK_14390

Expression Region:1-101

Sequence Info:full length protein