Gene Bio Systems
Recombinant Sulfolobus islandicus UPF0290 protein YN1551_1483 (YN1551_1483)
Recombinant Sulfolobus islandicus UPF0290 protein YN1551_1483 (YN1551_1483)
SKU:CSB-CF503197FPG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Uniprot NO.:C3NHG3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIAYDLLLSILIYLPAFIANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Protein Names:Recommended name: UPF0290 protein YN1551_1483
Gene Names:Ordered Locus Names:YN1551_1483
Expression Region:1-166
Sequence Info:full length protein
