Gene Bio Systems
Recombinant Sulfolobus islandicus UPF0290 protein M164_1356 (M164_1356)
Recombinant Sulfolobus islandicus UPF0290 protein M164_1356 (M164_1356)
SKU:CSB-CF504449FPE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Uniprot NO.:C4KH98
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Protein Names:Recommended name: UPF0290 protein M164_1356
Gene Names:Ordered Locus Names:M164_1356
Expression Region:1-166
Sequence Info:full length protein
