Gene Bio Systems
Recombinant Sulfolobus islandicus UPF0290 protein LS215_1460 (LS215_1460)
Recombinant Sulfolobus islandicus UPF0290 protein LS215_1460 (LS215_1460)
SKU:CSB-CF502509FPB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Uniprot NO.:C3MQ04
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Protein Names:Recommended name: UPF0290 protein LS215_1460
Gene Names:Ordered Locus Names:LS215_1460
Expression Region:1-166
Sequence Info:full length protein
