Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10(SIFV0010)

Recombinant Sulfolobus islandicus filamentous virus Putative transmembrane protein 10(SIFV0010)

SKU:CSB-CF838620SUY

Regular price $1,838.75 CAD
Regular price Sale price $1,838.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)

Uniprot NO.:Q914M0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNFSYFSTIFSIALMSSNAFAGNDTLLVGFCPCIEINTLTLFLSSLYAIKPSDSCSPSY TSNLLNLFCDFVNSSTHLSISVFSSSVLSCFTSCFVIYFYPFFVFDSASYCVFNSSSREG CTSVTIGWG

Protein Names:Recommended name: Putative transmembrane protein 10

Gene Names:Name:SIFV0010

Expression Region:1-129

Sequence Info:full length protein

View full details