Gene Bio Systems
Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain(atpP)
Recombinant Sulfolobus acidocaldarius Membrane-associated ATPase C chain(atpP)
SKU:CSB-CF678020FOZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Uniprot NO.:Q4J8L5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRKALLISLILPILIGGLVAAAQAPQDTPQGFMGINIGAGLAVGLAAIGAGVAVGTAAAA GIGVLTEKREMFGTVLIFVAIGEGIAVYGIIFAVLMLFAGI
Protein Names:Recommended name: Membrane-associated ATPase C chain
Gene Names:Name:atpP Ordered Locus Names:Saci_1552
Expression Region:1-101
Sequence Info:full length protein
