Gene Bio Systems
Recombinant Suid herpesvirus 1 Envelope protein US9 homolog
Recombinant Suid herpesvirus 1 Envelope protein US9 homolog
SKU:CSB-CF319987SRK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice))
Uniprot NO.:P11313
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPTAAPADMDTFDPSAPVPTSVSNPAADVLLAPKGPRSPLRPQDDSDCYYSESDNETPSE FLRRVGRRQAARRRRRRCLMGVAISAAALVICSLSALIGGIIARHV
Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): 11 kDa protein
Gene Names:
Expression Region:1-106
Sequence Info:full length protein
