
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: pat
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Streptomyces viridochromogenes
Delivery time: 3-7 business days
Uniprot ID: Q57146
AA Sequence: MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-183aa
Protein length: Full Length
MW: 36.6 kDa
Alternative Name(s): Phosphinothricin-resistance protein
Relevance: Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Reference: "Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli."Strauch E., Wohlleben W., Puehler A.Gene 63:65-74(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.