
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0A3H6
Gene Names: hup1
Organism: Streptomyces lividans
AA Sequence: MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAARTARNPQTGEPIQIPAGYSVKVSAGSKLKEAAKGK
Expression Region: 1-93aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 36.9 kDa
Alternative Name(s): HSl
Relevance: Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extre environmental conditions.
Reference: Cloning and sequencing of the hup gene encoding the histone-like protein HSl of Streptomyces lividans.Yokoyama E., Doi K., Ogata S.Biochim. Biophys. Acta 1353:103-106(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.