Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces coelicolor UPF0060 membrane protein SCO3297(SCO3297)

Recombinant Streptomyces coelicolor UPF0060 membrane protein SCO3297(SCO3297)

SKU:CSB-CF893998FOB

Regular price $2,034.20 CAD
Regular price Sale price $2,034.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

Uniprot NO.:Q9X889

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLVLRSAALFVVAALFEIGGAWLVWQGVREQRGWLWAAGGVLALGAYGFVATFQPDAHFG RILAAYGGIFVTGSILWGVVADGYRPDRWDIAGALVCLAGMALIMWAPRNGG

Protein Names:Recommended name: UPF0060 membrane protein SCO3297

Gene Names:Ordered Locus Names:SCO3297 ORF Names:SCE15.14

Expression Region:1-112

Sequence Info:full length protein

View full details