Gene Bio Systems
Recombinant Streptomyces coelicolor Uncharacterized protein SCO3924(SCO3924)
Recombinant Streptomyces coelicolor Uncharacterized protein SCO3924(SCO3924)
SKU:CSB-CF706624FOB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:Q53866
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MREIFTGLPWWVKWIAVPVIALVVFGGLIVSVVGFVVGLLFKLLVFVALVGGLIYVVRKF MSSSSSRSDW
Protein Names:Recommended name: Uncharacterized protein SCO3924
Gene Names:Ordered Locus Names:SCO3924 ORF Names:SCQ11.07
Expression Region:1-70
Sequence Info:full length protein
