Gene Bio Systems
Recombinant Streptomyces coelicolor ATP synthase protein I(atpI)
Recombinant Streptomyces coelicolor ATP synthase protein I(atpI)
SKU:CSB-CF358304FOB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:P0A302
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPSNDVRILLQAAVPAAAVGAVAAVVSAVVAGGKGAVGAVVATVLAMLFMGIGLYVLQRT AKSLPHLFQAMGLMLYAAQILLLFVFLAAFKNTTLFNPRSFAVSLLVVTLAWIAAQTRAH MKAKVLYVEPEPTGEKPEKTGHSS
Protein Names:Recommended name: ATP synthase protein I
Gene Names:Name:atpI Ordered Locus Names:SCO5366 ORF Names:2SC6G5.10
Expression Region:1-144
Sequence Info:full length protein
