Gene Bio Systems
Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)
Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)
SKU:CSB-BP001954SMT
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: apt
Biologically active: Not Tested
Expression system: Baculovirus
Species of origin: Streptococcus pyogenes serotype M1
Delivery time: 3-7 business days
Uniprot ID: P63546
AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-172aa
Protein length: Full Length
MW: 22,7
Alternative Name(s):
Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Reference: "Evolutionary origin and emergence of a highly successful clone of serotype M1 group A Streptococcus involved multiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
