Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

SKU:CSB-BP001954SMT

Regular price $782.50 CAD
Regular price Sale price $782.50 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: apt

Biologically active: Not Tested

Expression system: Baculovirus

Species of origin: Streptococcus pyogenes serotype M1

Delivery time: 3-7 business days

Uniprot ID: P63546

AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-172aa

Protein length: Full Length

MW: 22,7

Alternative Name(s):

Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Reference: "Evolutionary origin and emergence of a highly successful clone of serotype M1 group A Streptococcus involved multiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details