Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptococcus pneumoniae UPF0397 protein spr0429(spr0429)

Recombinant Streptococcus pneumoniae UPF0397 protein spr0429(spr0429)

SKU:CSB-CF816213SMP

Regular price $2,137.80 CAD
Regular price Sale price $2,137.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Uniprot NO.:Q8DQY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD

Protein Names:Recommended name: UPF0397 protein spr0429

Gene Names:Ordered Locus Names:spr0429

Expression Region:1-182

Sequence Info:full length protein

View full details