Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC)

Recombinant Staurastrum punctulatum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC)

SKU:CSB-CF658399SCAK

Regular price $2,048.20 CAD
Regular price Sale price $2,048.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staurastrum punctulatum (Green alga)

Uniprot NO.:Q32RZ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPILPKYESFWAFLLIACLIPVLAISVSNLVAPSTSKNPEKSTTYESGIEPMGESWIQFQ IRYYMFALVFVIFDVETVFLYPWAMSFDDLGIIAFAEVLVFVIILIIGLIYAWRKGALEW S

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3

Gene Names:Name:ndhC

Expression Region:1-121

Sequence Info:full length protein

View full details