Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0397 protein USA300HOU_2687 (USA300HOU_2687)

Recombinant Staphylococcus aureus UPF0397 protein USA300HOU_2687 (USA300HOU_2687)

SKU:CSB-CF427280SUM

Regular price $2,140.60 CAD
Regular price Sale price $2,140.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300 / TCH1516)

Uniprot NO.:A8Z5I6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE

Protein Names:Recommended name: UPF0397 protein USA300HOU_2687

Gene Names:Ordered Locus Names:USA300HOU_2687

Expression Region:1-184

Sequence Info:full length protein

View full details