Gene Bio Systems
Recombinant Staphylococcus aureus UPF0382 membrane protein SA0540(SA0540)
Recombinant Staphylococcus aureus UPF0382 membrane protein SA0540(SA0540)
SKU:CSB-CF758946SKY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain N315)
Uniprot NO.:Q7A763
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG
Protein Names:Recommended name: UPF0382 membrane protein SA0540
Gene Names:Ordered Locus Names:SA0540
Expression Region:1-122
Sequence Info:full length protein
