Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0382 membrane protein SA0540(SA0540)

Recombinant Staphylococcus aureus UPF0382 membrane protein SA0540(SA0540)

SKU:CSB-CF758946SKY

Regular price $2,049.60 CAD
Regular price Sale price $2,049.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain N315)

Uniprot NO.:Q7A763

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG

Protein Names:Recommended name: UPF0382 membrane protein SA0540

Gene Names:Ordered Locus Names:SA0540

Expression Region:1-122

Sequence Info:full length protein

View full details