GeneBio Systems
Recombinant Staphylococcus aureus Type VII secretion system extracellular protein B (esxB)
Recombinant Staphylococcus aureus Type VII secretion system extracellular protein B (esxB)
SKU:P0C047
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P0C047
Gene Names: esxB
Alternative Name(s): (Ess extracellular protein B)
Abbreviation: Recombinant Staphylococcus aureus esxB protein
Organism: Staphylococcus aureus (strain Newman)
Source: E.coli
Expression Region: 1-104aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP
MW: 19.0 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Virulence factor that is important for the establishment of infection in the host. EsxB is required for EsxA synthesis as well as secretion . Mediates together with EsxA the release of S.aureus from the host cell. Inhibits also host cytokine production and thus modulates dendritic cell-mediated immunity .
Reference: "EsxA and EsxB are secreted by an ESAT-6-like system that is required for the pathogenesis of Staphylococcus aureus infections." Burts M.L., Williams W.A., DeBord K., Missiakas D.M. Proc. Natl. Acad. Sci. U.S.A. 102: 1169-1174(2005)
Function:
