>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: tst
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Staphylococcus aureus
Delivery time: 3-7 business days
Uniprot ID: P06886
AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 41-234aa
Protein length: Full Length of Mature Protein
MW: 37.9 kDa
Alternative Name(s): TSST-1
Relevance: Responsible for the symptoms of toxic shock syndrome.
Reference: "The nucleotide and partial amino acid sequence of toxic shock syndrome toxin-1."Blomster-Hautamaa D.A., Kreiswirth B.N., Kornblum J.S., Novick R.P., Schlievert P.M.J. Biol. Chem. 261:15783-15786(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.