Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2(mnhG2)

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2(mnhG2)

SKU:CSB-CF643893SKZ

Regular price $2,083.20 CAD
Regular price Sale price $2,083.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FJ09

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND

Protein Names:Recommended name: Putative antiporter subunit mnhG2 Alternative name(s): Mrp complex subunit G2 Putative NADH-ubiquinone oxidoreductase subunit mnhF2

Gene Names:Name:mnhG2 Synonyms:mrpG2 Ordered Locus Names:SAUSA300_0616

Expression Region:1-145

Sequence Info:full length protein

View full details