
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain NCTC 8325)
Uniprot NO.:Q2FZK2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEG KDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
Protein Names:Recommended name: Probable quinol oxidase subunit 4 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide IV
Gene Names:Name:qoxD Ordered Locus Names:SAOUHSC_00999
Expression Region:1-96
Sequence Info:full length protein