Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD(icaD)

SKU: CSB-CF886516FLF

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain NCTC 8325)

Uniprot NO.:Q9RQP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Protein Names:Recommended name: Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD Short name= PGA synthesis protein IcaD Short name= Poly-beta-1,6-GlcNAc synthesis protein IcaD Alternative name(s): Biofilm polysaccharide intercellular ad

Gene Names:Name:icaD Ordered Locus Names:SAOUHSC_03003

Expression Region:1-101

Sequence Info:full length protein