Gene Bio Systems
Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD(icaD)
Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD(icaD)
SKU:CSB-CF762378SUL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain MW2)
Uniprot NO.:Q79ZV3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES
Protein Names:Recommended name: Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD Short name= PGA synthesis protein IcaD Short name= Poly-beta-1,6-GlcNAc synthesis protein IcaD Alternative name(s): Biofilm polysaccharide intercellular ad
Gene Names:Name:icaD Ordered Locus Names:MW2587
Expression Region:1-101
Sequence Info:full length protein
