Recombinant Staphylococcus aureus  Na(+)-H(+) antiporter subunit G1(mnhG1)

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit G1(mnhG1)

CSB-CF640258FLF
Regular price
$1,460.00 CAD
Sale price
$1,460.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain NCTC 8325)

Uniprot NO.:Q2G2H9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1

Gene Names:Name:mnhG1 Ordered Locus Names:SAOUHSC_00883

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share